Alpha stage software — under active development. Data may be incomplete or change without notice.

↑↓ navigate open esc close

Meanings

  1. 1
  2. 2

Thesaurus

Forms maths
Derived forms mathbabblemathcoremathleticmathleticsmathmlmathspeakmathwisemathymeadernonmath

Common collocations

Etymology

From Middle English math, from Old English mǣþ (“a mowing, that which is mown, cutting of grass”), from Proto-Germanic *mēþą (“a mowing”), from Proto-Indo-European *h₂meh₁- (“to mow”); equivalent to mow + -th (abstract nominal suffix). Cognate with German Mahd (“a mowing, reaping”), West Frisian mêd (“area of land that can be mown in one day; domain, realm”). Related also to Old English mǣd (“mead, meadow, pasture”). See meadow.

View etymology graph ->

Topics

markdown

Send feedback

What is this about?

Choose the closest match.

Optional — only if you'd like a reply.