Alpha stage software — under active development. Data may be incomplete or change without notice.
Thesaurus
Derived forms
mathbabblemathcoremathleticmathleticsmathmlmathspeakmathwisemathymeadernonmath
From Middle English math, from Old English mǣþ (“a mowing, that which is mown, cutting of grass”), from Proto-Germanic *mēþą (“a mowing”), from Proto-Indo-European *h₂meh₁- (“to mow”); equivalent to mow + -th (abstract nominal suffix). Cognate with German Mahd (“a mowing, reaping”), West Frisian mêd (“area of land that can be mown in one day; domain, realm”). Related also to Old English mǣd (“mead, meadow, pasture”). See meadow.
View etymology graph ->
General
Open this dialog?
Close dialogEsc
Open search⌘K
Press ? anytime to toggle this dialog