Alpha stage software — under active development. Data may be incomplete or change without notice.

↑↓ navigate open esc close
UK /kɹæɡ/
Freq #60127

Meanings

  1. 1
  2. 2
  3. 3
  4. 4

Thesaurus

Forms cragsman
Derived forms cragboundcragfastcraggedcraggercraggycraglikecragsmancragswoman

From 13th century Middle English crag, from Middle Irish crec, a contracted form of Middle Irish carrac (compare Irish creig, Scottish Gaelic creag), possibly ultimately from the late Proto-Indo-European/substrate *kar (“stone, hard”); see also Old Armenian քար (kʻar, “stone”), Sanskrit खर (khara, “hard, solid”), Welsh carreg (“stone”).

Topics

markdown

Send feedback

What is this about?

Choose the closest match.

Optional — only if you'd like a reply.